PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g24210.2.p
Common NameBRADI_3g24210, LOC100831355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 542aa    MW: 60381.1 Da    PI: 5.8482
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g24210.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS427.69.7e-1311725402373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       +e++++c +av+++d  +++ l+++l +l+s +gdpmqRl ay++e+L arl++s+s++yk+l++++ +    se +++++l++e++P++kf+
  Bradi3g24210.2.p 172 KEVIIACGKAVAENDVFATELLISELGQLVSVSGDPMQRLGAYMLEGLVARLSSSGSKIYKSLRCKQPT---GSELMSYMSLLYEICPFYKFG 261
                       6889****************************************************************9...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ++ aN aI ea++ge+ vHiiDf+i qG QW++ +qaLa+Rp+gpp lRiTg+++++s   +   l  +g rL k+ +++g+pfefn+ +  +
  Bradi3g24210.2.p 262 YMSANGAIAEAIKGENFVHIIDFQIAQGSQWVTVIQALAARPGGPPCLRITGIDDSDSIyaRGGGLDIVGTRLYKVSRACGLPFEFNA-IPAA 353
                       *******************************************************888799999************************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                        ++++le+L+++pgE+++Vn+++qlh+++desvs+e++rd++L+++kslsP+vv++veqe+++n+++F+ r le+l+yy+a+f+s++a lpr+
  Bradi3g24210.2.p 354 SHEVHLEHLDIRPGEVIVVNFAYQLHHTPDESVSMENHRDRILRMIKSLSPRVVTLVEQESNTNTAPFFPRYLETLDYYTAMFESIDAALPRD 446
                       9******************************************************************************************** PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       ++ r++ E+++++r+ivn++acega+r+erhe ++kW++r+ +aGF+++pls+ +++++k+ll  ++ + yr+ee++g l+lgWk+r Lv+ S
  Bradi3g24210.2.p 447 DKRRMSAEQHCVARDIVNLIACEGADRIERHEVFGKWKARFAMAGFRQYPLSSVVNNTIKTLLDSYN-NYYRLEERDGVLYLGWKNRVLVVSS 538
                       *******************************************************************.55*********************** PP

              GRAS 372 aW 373
                       aW
  Bradi3g24210.2.p 539 AW 540
                       ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.513145522IPR005202Transcription factor GRAS
PfamPF035143.3E-128172540IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004871Molecular Functionsignal transducer activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MWAKASDHTY RRSDDQRMAY YNNSVPSREN GRFYVAQSHI DLHYTSSDDG SQKIRSNPQV  60
FEPQYCTLES SSGNGVYPTQ SSTSSHSISP ISGSPLSQHD SHSDHIYGSP PSASCVTEVA  120
DLQVKLKELE DAILGPELDI TSDSPESSLQ AINPLKPDNW RQLLGIYTGD LKEVIIACGK  180
AVAENDVFAT ELLISELGQL VSVSGDPMQR LGAYMLEGLV ARLSSSGSKI YKSLRCKQPT  240
GSELMSYMSL LYEICPFYKF GYMSANGAIA EAIKGENFVH IIDFQIAQGS QWVTVIQALA  300
ARPGGPPCLR ITGIDDSDSI YARGGGLDIV GTRLYKVSRA CGLPFEFNAI PAASHEVHLE  360
HLDIRPGEVI VVNFAYQLHH TPDESVSMEN HRDRILRMIK SLSPRVVTLV EQESNTNTAP  420
FFPRYLETLD YYTAMFESID AALPRDDKRR MSAEQHCVAR DIVNLIACEG ADRIERHEVF  480
GKWKARFAMA GFRQYPLSSV VNNTIKTLLD SYNNYYRLEE RDGVLYLGWK NRVLVVSSAW  540
W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-571755408374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573869.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_010234693.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_014756863.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLI1I3Q20.0I1I3Q2_BRADI; Uncharacterized protein
STRINGBRADI3G24210.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Representative plantOGRP14091447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein